PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01819.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB_related
Protein Properties Length: 1582aa    MW: 172138 Da    PI: 6.371
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01819.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.63.4e-09756798347
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     +WT+eE e++ +  +++G++ +++I++ +  ++t  +c+++++k+
  Zmw_sc01819.1.g00050.1.sm.mkhc 756 PWTQEEKEIFMETLAKFGKD-FSKISSFIT-HKTTADCVEFYYKH 798
                                     8*****************99.********9.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.65E-15740801IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-7747801IPR009057Homeodomain-like
PROSITE profilePS5129315.886752803IPR017884SANT domain
SMARTSM007171.8E-8753801IPR001005SANT/Myb domain
PfamPF002492.8E-7755798IPR001005SANT/Myb domain
PROSITE profilePS5129312.6669601011IPR017884SANT domain
SMARTSM007171.3E-69611009IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-49641006IPR009057Homeodomain-like
SuperFamilySSF466893.9E-99641011IPR009057Homeodomain-like
CDDcd001676.13E-59651003No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1582 aa     Download sequence    Send to blast
MRDHARPSPR RAPSSVSIGT PAPRKSSDLR PLPPPPPSPA PLISPNPSAV SESYYRQGGG  60
AYDRPYPDEM PLGYTPSRSD RYWMDDEGGG YKGFSRYGGG RRDGRDMRGS YRRSPFRSYG  120
NDFSRNHQEQ PPPPPPRRSP LRSVALPIYD PPGNRVDRGD RDSLPRVTPW RRRENRSEAA  180
GAAGAGHVSA GQSALLAASG NEVSAHPPAV TSPHGAEEAP RKKARLGWGQ GLAKYEKQKV  240
QGPTDPSEDV ALGSPAESSF SCTCSCAMHI DDCCATISTS AMCIPSCGAA TSTSTMRIPG  300
FCTITSIYGM CISGFCSGTC TSRMYISSSS TITSICGTTC TSTMCICDTT CTCTSMCISA  360
PEVKSCDLTA NTVLNSTQDT PGADDQACNN EFPIKIDQLG DDRIDSLATL LAKFLEHDSC  420
HGDSKDPSST SKLLLLKESI SKEIEKTELE IDSLEGELKS VNTVAPEDSP TGVTYTENIS  480
PPSGTSKVPG CDKSHVKEPR ELSPFPKIPI VQDANVKDAE NMDIETAPVH NAKTASEESA  540
ACPENQAQAA ADVGPVNVSG GAGPQIDVDN ERLEVSSCHI DTDSVKADGG VDLRGRQCLY  600
PNHDLLSSVT SSNHDIAKEA NESVFKCLSG DTPRLDLLDT SHVSIERKNV SFIKEKLMLR  660
KSRLSFKEQA LTFKFRVLRY LWKEDMRAQS LVSALIKPAG HHILDLRDNV KRRRNYFKMP  720
ALIINEKEKE CSRFLSKNGL IEDPVAVEKE RVMINPWTQE EKEIFMETLA KFGKDFSKIS  780
SFITHKTTAD CVEFYYKHHK SDSFREVKKL LDQHQQQQPT STFLGAKSGK KWNREANAAS  840
LDILGIASAV AAQGLEYEKR VEKFSAKSLI RNVSNVSFVA RKSSRECFDN TSLHERESVA  900
ADVLAGICGT LSPEGMSSCI TSSADPGQKI NITRMENALT LEISKNVDDE DTLSDIECEV  960
DPVDWNDDEK QIFIEAMNNY GKDFARISSC VKSKSYEQCK VFFSKARKSL GLDLIHQGAA  1020
DINMPTSDTN GGRSDTDEAC AAEMDSAICS TQSFAKTEMD VCPTERAVQG PSSCVISKQT  1080
EGDGSNDCNV LDVNTECENK ADKTCDDQKR FNEVAHQSQC GPIDINCPET PEKLEVTADT  1140
VDQMNMHNSS AVISSKDQPE ARMDGCSHPA LDNALVKAGT ADPSASMVAE SGIKENIHHF  1200
SNPPSTSSYQ HSVPRDKPPS KPKPQVTPLT PKDLMPVQFS SVLPDPTSIR FEGIASITTP  1260
NFEDTGNRAC NALEAKDMNK YPAFKEQSQA GQHDLLFHNI DGYKKHLATE ASIFSERNTC  1320
GTVSTSQSDR FTVTKFQNGR SNSLGGLPNT KGIHWDREHN EVSDGSLRHC SHNTSSDSNE  1380
QIKRLGDVKL FGQILSHQSS QNSGSSCNGS KNKPSLPNVD TSSMRLLNSP RDHVSCSPRP  1440
VATGHLGLDN RSVRTYGHLD GSTTQPEPLP TMAKCQTSLS GVPFYSAKNG TRGMFSGYQQ  1500
PLMQAHQSDP KLLERYSDPH KRNGMEFISG FQQQPGKVSL FGGAGVLVSG VSDPVAALKA  1560
QYGPGSKITS CDVDPWKDIG SR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C3e-14719805994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D3e-14719805994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960366.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_004960367.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_012700232.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
TrEMBLK3Z3350.0K3Z335_SETIT; Uncharacterized protein
STRINGSi020953m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549